DPCfam | MC400677
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 327 ± 29 aa |
| Residues in low-complexity regions (%) | 2.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06742 |
| Sequences matching dominant architecture (%) | 45.26 |
| Average overlap percent | 20.94 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009FE48C0 | 42-358 | 317 | GADVAEGFRYVLHVLADQIDRAGTRASGRPLFLPGVTPVRKLFFDNPDTEYDIALISSRRSYRIRGDRGTVPYLAFCVYGATNAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EP28-F1 | 36-370 | 99.70 | 94.22 | View in AlphaFoldDB ↗ |