DPCfam | MC400649
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 296 ± 41 aa |
| Residues in low-complexity regions (%) | 36.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 62.48 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7SYY5 | 1-354 | 354 | MRHHKHFHKRQDESSGWDKFVEGFGDIFNENDDTTTPAVVVKAPATVFKTVYETQSKTFDGEIGGWSTVGAAEATEKSAEPTTTE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NL72-F1 | 3-299 | 98.63 | 56.03 | View in AlphaFoldDB ↗ |