DPCfam | MC400596
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 85 ± 13 aa |
| Residues in low-complexity regions (%) | 4.53 |
| Residues in coiled-coil regions (%) | 34.5 |
| Predicted disordered residues (%) | 36.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15669 |
| Sequences matching dominant architecture (%) | 97.3 |
| Average overlap percent | 37.58 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009A2AC5B | 121-198 | 78 | INAIKDKINVGNIDEVVAHLQSTLQEECNTLEKHIEFLQECIEEEHNYSLNSTTQNSIPSIAELKDERKILERDLQQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8N4L8-F1 | 143-225 | 96.51 | 77.40 | View in AlphaFoldDB ↗ |