DPCfam | MC400543
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 561 |
|---|---|
| Mean domain length (aa) | 368 ± 61 aa |
| Residues in low-complexity regions (%) | 6.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.26 |
| Average transmembrane regions | 7.99 |
| Dominant Pfam architecture(s) | PF01773- PF07662 |
| Sequences matching dominant architecture (%) | 52.51 |
| Average overlap percent | 96.34 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0T6B121 | 4-291 | 288 | IVEVLGSFLHSIIGSSICESVNSAANIFLGQSESPLLLKPYLKNLTSSEFHTMISSGFATVSGTVLAAYISFGAKAEHLITATVM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8VIH3-F1 | 231-628 | 99.74 | 91.01 | View in AlphaFoldDB ↗ |