DPCfam | MC399872
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 413 ± 50 aa |
| Residues in low-complexity regions (%) | 3.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A061E6G9 | 31-444 | 414 | KRDLMQLLDKHAVKSVEESIFVEPKPLTAVELFAKKKEQGGSSVRNKKIYKLGGKELLVLVTKSAGSTKIHLAADFEEPLTLHWA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7MS29-F1 | 443-867 | 99.50 | 86.24 | View in AlphaFoldDB ↗ |