DPCfam | MC399746
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 98 ± 14 aa |
| Residues in low-complexity regions (%) | 4.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.14 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00453 |
| Sequences matching dominant architecture (%) | 96.49 |
| Average overlap percent | 89.92 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q235I3 | 11-105 | 95 | KLARGFFGRNKNCLRTMAPRVDKALRYSFRDRRARRRIYRKEWIQTINAAVREHNTPYNRFIWALNQSNIILDRKILSNLAINEP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q942D0-F1 | 2-100 | 95.19 | 94.42 | View in AlphaFoldDB ↗ |