DPCfam | MC399719
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 165 ± 14 aa |
| Residues in low-complexity regions (%) | 2.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.34 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F2QRY1 | 1457-1616 | 160 | IFNDFQGAKKEMLALVNLKAHSKALVSIWKPENEIPGKHFVYNYTYVIFFVDILFELEDINSMITLCKKLRKIGQNLVQPSKAWD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ADX2-F1 | 1328-1488 | 99.37 | 85.10 | View in AlphaFoldDB ↗ |