DPCfam | MC399670
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 721 |
|---|---|
| Mean domain length (aa) | 476 ± 47 aa |
| Residues in low-complexity regions (%) | 3.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.77 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01343- PF01343 |
| Sequences matching dominant architecture (%) | 94.86 |
| Average overlap percent | 82.35 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K2K7H2 | 40-538 | 499 | SRWQAPELPPRVLLHLPLAGALPEQESDAVQALIRQQQQPSLRQVLEALDRAAIDPRVGGILADLSHAQLGLAQAQELHQAILRF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0F9M4-F1 | 119-576 | 97.60 | 93.61 | View in AlphaFoldDB ↗ |