DPCfam | MC399627
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Residues in low-complexity regions (%) | 20.49 |
| Residues in coiled-coil regions (%) | 17.37 |
| Predicted disordered residues (%) | 56.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007DCA262 | 493-627 | 135 | DLEWKKQQQVDLLQELEEQKVKLEQMLLEAQQERERLKTAVNQEETIYKQQSDQGWDVTLVCPGQPSELDPPADENDHNRRIREY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9C0D2-F1 | 514-622 | 97.67 | 71.95 | View in AlphaFoldDB ↗ |