DPCfam | MC399545
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 358 ± 43 aa |
| Residues in low-complexity regions (%) | 2.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.41 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF14765 |
| Sequences matching dominant architecture (%) | 29.41 |
| Average overlap percent | 5.28 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E2C8B1 | 397-713 | 317 | VPVRIYGSLDAIVSGGIEIYGQRFVAISRRPANIKPVHEEYKFIGYRDHTTISLKDAVQISIQIALECHELRNVKVIEVVEDDDK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B7Z001-F1 | 1213-1578 | 97.44 | 87.83 | View in AlphaFoldDB ↗ |