DPCfam | MC39943
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Residues in low-complexity regions (%) | 0.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 49.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003C192A2 | 57-151 | 95 | YADTFSTPNDPGTAKVKARPTVKIFPQTPTNSLPESQGFPVPTPSVPELSSRNETATSQVAGNGLSVNGDNQTYASVGNFKHYSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5T0Z8-F1 | 50-140 | 100.00 | 47.87 | View in AlphaFoldDB ↗ |