DPCfam | MC399259
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 101 ± 24 aa |
| Residues in low-complexity regions (%) | 8.05 |
| Residues in coiled-coil regions (%) | 2.52 |
| Predicted disordered residues (%) | 58.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15235 |
| Sequences matching dominant architecture (%) | 95.65 |
| Average overlap percent | 81.38 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009D97771 | 259-344 | 86 | AKSPVKDVKWDAEGMTWEVYGASVDPEELGLAIQRHLELQIKETASRVTKLMRQNTNTSQQSMNVSSNRKNSRMTAPFRRMTCCS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3UNH4-F1 | 824-927 | 94.78 | 64.02 | View in AlphaFoldDB ↗ |