DPCfam | MC399083
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 84 ± 11 aa |
| Residues in low-complexity regions (%) | 3.05 |
| Residues in coiled-coil regions (%) | 0.26 |
| Predicted disordered residues (%) | 20.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10070 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 13.48 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M0K5C5 | 865-954 | 90 | GAGTKAPMNLVGHFGVSQGSAGDLLVGLPTQMTEFHTPVRALYVIDAPVSRVEEVLKRRKELANLVYNDWVRMVIRDPVSKDFYR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A7NGU9-F1 | 740-830 | 97.85 | 96.34 | View in AlphaFoldDB ↗ |