DPCfam | MC398924
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 90 ± 17 aa |
| Residues in low-complexity regions (%) | 2.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.34 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05641 |
| Sequences matching dominant architecture (%) | 71.6 |
| Average overlap percent | 21.96 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K9NRE5 | 94-197 | 104 | GWWIGKVKDVVKSSDDGVGYRVWFPESKEEIEFRREEVREHLDWIAGVWRKSSINEKNEEIDDDDDGGGGGDSATKLSVGQQVEV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q500V5-F1 | 132-248 | 98.04 | 74.98 | View in AlphaFoldDB ↗ |