DPCfam | MC398869
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 67 ± 11 aa |
| Residues in low-complexity regions (%) | 2.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.09 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01963 |
| Sequences matching dominant architecture (%) | 99.4 |
| Average overlap percent | 21.46 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F0R9N6 | 8-77 | 70 | VLLLFLCFGNAQEKNSLLWEISGNGLKQTSYLYGTMHVSKKVAFRLDDVFYESLLKSDVVALESDPATWL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5K4FF49-F1 | 106-165 | 84.93 | 90.36 | View in AlphaFoldDB ↗ |