DPCfam | MC398669
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 4371 |
|---|---|
| Mean domain length (aa) | 172 ± 28 aa |
| Residues in low-complexity regions (%) | 1.97 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 20.06 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF02661 |
| Sequences matching dominant architecture (%) | 85.39 |
| Average overlap percent | 58.01 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J5HN35 | 50-231 | 182 | YSARIEGNPLHPSEISEIIDNESDDIYQVEVKNLHKAYNFIYQSENNKPISLELIKDLHLKTMQNLSPMAGKFRQEPWAIFDQNG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0K0JSP4-F1 | 239-416 | 97.69 | 94.71 | View in AlphaFoldDB ↗ |