DPCfam | MC398651
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Residues in low-complexity regions (%) | 8.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.57 |
| Average transmembrane regions | 1.14 |
| Dominant Pfam architecture(s) | PF03176 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 25.47 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R1ZM61 | 1202-1272 | 71 | VNKSIKGTSLSGAKVALGGQTAYINDTRNVASKDFIRTAIIMLTGILLALMLITRSILQPFYILGTLLLAY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P96706-F1 | 683-749 | 97.10 | 91.28 | View in AlphaFoldDB ↗ |