DPCfam | MC398412
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 611 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Residues in low-complexity regions (%) | 0.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.77 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF14280 |
| Sequences matching dominant architecture (%) | 99.13 |
| Average overlap percent | 86.84 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009EE00A8 | 9-148 | 140 | TGAVGQTAVTGQFEKLGWGVAPNPTQHDLGTDLWLQARDDRGFDLGALVGAQVKSGPSWFQHPSSGRDGLPPGWWFRDSDDRHAQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54HU8-F1 | 72-190 | 95.24 | 63.40 | View in AlphaFoldDB ↗ |