DPCfam | MC39840
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 361 |
|---|---|
| Mean domain length (aa) | 94 ± 17 aa |
| Residues in low-complexity regions (%) | 3.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.57 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF16470 |
| Sequences matching dominant architecture (%) | 97.32 |
| Average overlap percent | 79.5 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A195B805 | 25-157 | 133 | EWVVRIAGGSQVASLLAAQSGYKHHGPVLGFKDTYIWHKDDNPNQKKRGNIRLTKALNANSKIVWADQQKIVKRLKRDFISFIDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P23188-F1 | 29-124 | 97.96 | 90.95 | View in AlphaFoldDB ↗ |