DPCfam | MC39836
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 411 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Residues in low-complexity regions (%) | 3.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00720 |
| Sequences matching dominant architecture (%) | 91.29 |
| Average overlap percent | 77.58 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004B8779D | 19-122 | 104 | LTVEIRQSETAEPVGYVLECSGDTPGPNTTLPNATQACATVQRLGADFFNALPDANVACTQQYGGPQTASISGTVDGTQVRARFA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EUV7-F1 | 40-134 | 97.94 | 96.01 | View in AlphaFoldDB ↗ |