DPCfam | MC398186
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 467 ± 98 aa |
| Residues in low-complexity regions (%) | 1.65 |
| Residues in coiled-coil regions (%) | 0.08 |
| Predicted disordered residues (%) | 14.81 |
| Average transmembrane regions | 0.15 |
| Dominant Pfam architecture(s) | PF11277 |
| Sequences matching dominant architecture (%) | 88.0 |
| Average overlap percent | 55.66 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182FD56 | 468-893 | 426 | SEMKLFDGGVVEPITYCLQPLLAVEVLLNPMSDTAQYVSQLINLRRLKGFSNARLYCELVRGCFMSLNNVEGTSKESLLCAFAFI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q16X15-F1 | 259-788 | 99.81 | 88.85 | View in AlphaFoldDB ↗ |