DPCfam | MC39785
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Residues in low-complexity regions (%) | 1.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08343- PF00317 |
| Sequences matching dominant architecture (%) | 84.09 |
| Average overlap percent | 59.52 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W6JK53 | 1-110 | 110 | MTVTKIETKESVTPEYFMLNNQLNIVKDGKIQLNADREAVHSYFIDYVNPHTVYFGDLREKLDYLVKHKYIKGEVLDKYTFKFIK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0A5W9-F1 | 26-122 | 98.97 | 94.59 | View in AlphaFoldDB ↗ |