DPCfam | MC397460
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 97 ± 15 aa |
| Residues in low-complexity regions (%) | 0.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.76 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02946 |
| Sequences matching dominant architecture (%) | 2.59 |
| Average overlap percent | 55.93 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D0BRC2 | 5-68 | 64 | VACAHPKAVVAFKKLPHDPRHMKTSEALQFLEFIQAHQKEHPDNIFKFHHWIDENKNLQESMEG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2K5X2-F1 | 900-980 | 75.49 | 82.75 | View in AlphaFoldDB ↗ |