DPCfam | MC39723
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 437 ± 40 aa |
| Residues in low-complexity regions (%) | 1.7 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 18.45 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00271- PF11907 |
| Sequences matching dominant architecture (%) | 89.84 |
| Average overlap percent | 88.59 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I0KXF7 | 42-441 | 400 | RELRVLFTVDLFNEGVDLPMVDTILRLRPTESATIFLQQLGRGLRLDDDKSCLTVLDFIGGQNANFRFDLRWQALTGDSRRAVEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FVC3-F1 | 501-950 | 100.00 | 89.45 | View in AlphaFoldDB ↗ |