DPCfam | MC397114
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 137 ± 12 aa |
| Residues in low-complexity regions (%) | 6.28 |
| Residues in coiled-coil regions (%) | 0.13 |
| Predicted disordered residues (%) | 3.4 |
| Average transmembrane regions | 2.6 |
| Dominant Pfam architecture(s) | PF11374 |
| Sequences matching dominant architecture (%) | 0.67 |
| Average overlap percent | 59.69 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0H2RT86 | 18-176 | 159 | IALVLIGMGLMLAHHFFYAYLNEKPINSGSIGLPPFLKNQNNASFIGTAIAHGARIAFSMAIGVTFAQLFWDTLRKRAHTIEQID... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q030-F1 | 69-228 | 97.79 | 81.66 | View in AlphaFoldDB ↗ |