DPCfam | MC397017
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 282 ± 57 aa |
| Residues in low-complexity regions (%) | 1.57 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.0 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF07137 |
| Sequences matching dominant architecture (%) | 95.45 |
| Average overlap percent | 87.92 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E1ZFV4 | 78-348 | 271 | SKVGTCLLQNCQAALANCLTDTICAENLICLQVCNGRPDETECQIKCGDKYADKAVETFTACAISEQKCVPQRVDEGLFPVPPDC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1K4S1-F1 | 288-551 | 99.22 | 94.57 | View in AlphaFoldDB ↗ |