DPCfam | MC39694
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 180 ± 27 aa |
| Residues in low-complexity regions (%) | 1.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.82 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF03587 |
| Sequences matching dominant architecture (%) | 96.0 |
| Average overlap percent | 90.01 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J1J158 | 49-238 | 190 | KVGNTFELLNCDDHLQILKKYNRDPGSCRPDITHQSLLMLMDSPLNRAGMLQVYIKTEKNVLIEINPQTRIPRTFKRFAGLMVQL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q10107-F1 | 166-353 | 98.40 | 93.73 | View in AlphaFoldDB ↗ |