DPCfam | MC396760
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Residues in low-complexity regions (%) | 0.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08722- PF08721 |
| Sequences matching dominant architecture (%) | 89.66 |
| Average overlap percent | 32.99 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00064B7A29 | 65-121 | 57 | ARTIKPSKELENQRTIEKLEIERSYWEDRGIDWGIVTEKEMPRNLIENVEWLHSSYF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P13988-F1 | 127-183 | 95.00 | 95.35 | View in AlphaFoldDB ↗ |