DPCfam | MC396626
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 59 ± 7 aa |
| Residues in low-complexity regions (%) | 2.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.42 |
| Average transmembrane regions | 0.94 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A124SF67 | 403-460 | 58 | VKRAMARKYEFPTVVARLLTVGFIILTSFWLFFPPLIKSGADVKALEEFKFFVDYVKN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1KYE6-F1 | 282-340 | 96.67 | 90.00 | View in AlphaFoldDB ↗ |