DPCfam | MC396509
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 132 ± 16 aa |
| Residues in low-complexity regions (%) | 3.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.26 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01569 |
| Sequences matching dominant architecture (%) | 77.97 |
| Average overlap percent | 11.81 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1N6KIV0 | 173-319 | 147 | TPGTNPGDWRPTPTAFAPAQTPQWPDVTPFALNSGSQFRPGPPPALTSPKYTAAFNEVKDFGRVDSTVRTAQQTDVARFWEGKAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54FF5-F1 | 206-337 | 97.67 | 92.02 | View in AlphaFoldDB ↗ |