DPCfam | MC395513
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 58 ± 8 aa |
| Residues in low-complexity regions (%) | 0.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03144 |
| Sequences matching dominant architecture (%) | 81.25 |
| Average overlap percent | 62.77 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0DJ57 | 40-106 | 67 | RSELWGANYKVGKKEDLFEKAIQRTVLMMASRVEYIPDVPCGNTVGLVGVDQYLMKTGTISDHPDCH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077Z0M0-F1 | 430-487 | 100.00 | 91.56 | View in AlphaFoldDB ↗ |