DPCfam | MC395356
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 118 ± 20 aa |
| Residues in low-complexity regions (%) | 0.88 |
| Residues in coiled-coil regions (%) | 0.45 |
| Predicted disordered residues (%) | 14.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17751 |
| Sequences matching dominant architecture (%) | 81.96 |
| Average overlap percent | 82.91 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L8Y9V0 | 342-436 | 95 | WTMENDMLISYSTTPGFPCSSWDWIGLYKVGLRHINDYVSYAWVGDNQVSFSNNLNQVYIDIKDVPETKDQFLLCYYSNNLNSVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4R914-F1 | 20-130 | 96.64 | 90.45 | View in AlphaFoldDB ↗ |