DPCfam | MC395081
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Residues in low-complexity regions (%) | 0.62 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 13.26 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF12796 |
| Sequences matching dominant architecture (%) | 5.11 |
| Average overlap percent | 4.82 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A094HZJ4 | 8-84 | 77 | DAEINIAVICVTYLSFNDFKTGICQTDEEFEERLQSNLLYNYASHNWGHHARRGPTLIPEVISFLETKAQVEASSQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NTJ1-F1 | 758-837 | 100.00 | 85.69 | View in AlphaFoldDB ↗ |