DPCfam | MC395006
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Residues in low-complexity regions (%) | 5.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.83 |
| Average transmembrane regions | 0.23 |
| Dominant Pfam architecture(s) | PF17648 |
| Sequences matching dominant architecture (%) | 1.37 |
| Average overlap percent | 4.23 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J9REH1 | 46-127 | 82 | LIHRDYRAFLSLGAGGTPQTFLSGYLRVKLLSVFALSSPRSPAPVPADLRQTGYLVGSSLPARRGPRPTVVGIAPHRQTTQR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W7X0-F1 | 63-154 | 94.06 | 93.75 | View in AlphaFoldDB ↗ |