DPCfam | MC394526
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 9.77 |
| Predicted disordered residues (%) | 26.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00631 |
| Sequences matching dominant architecture (%) | 87.18 |
| Average overlap percent | 89.18 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000674BD0A | 218-294 | 77 | RNFQPSQMAARRKKNKDLLQKEIKYLHRSINICRVKTSKAVENLEHFTEQYFDLDPLLTPPMPSNPWISDDTTYFEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9Z2H2-F1 | 254-321 | 95.77 | 95.12 | View in AlphaFoldDB ↗ |