DPCfam | MC394094
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 117 ± 22 aa |
| Residues in low-complexity regions (%) | 0.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.5 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF07653 |
| Sequences matching dominant architecture (%) | 19.23 |
| Average overlap percent | 20.69 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2NER0 | 686-859 | 174 | RFYEAYKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSRECRVWLSLGCSDLGCAAPHSGWAGLTPAGPCSP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9V3Z6-F1 | 1465-1598 | 99.26 | 80.00 | View in AlphaFoldDB ↗ |