DPCfam | MC393845
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 581 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Residues in low-complexity regions (%) | 3.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.64 |
| Average transmembrane regions | 1.21 |
| Dominant Pfam architecture(s) | PF02705 |
| Sequences matching dominant architecture (%) | 98.61 |
| Average overlap percent | 29.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D9MLM4 | 65-156 | 92 | RNLLLTVAALGVVFGDIGTSPLYSVQTAFALADGAIAPNPENIMGIISMIFWSLTLIVALKYCVLVMHADDEGEGGVLVLAALVA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9M7J9-F1 | 22-112 | 94.79 | 82.50 | View in AlphaFoldDB ↗ |