DPCfam | MC39379
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Residues in low-complexity regions (%) | 17.8 |
| Residues in coiled-coil regions (%) | 0.31 |
| Predicted disordered residues (%) | 5.14 |
| Average transmembrane regions | 2.19 |
| Dominant Pfam architecture(s) | PF12679 |
| Sequences matching dominant architecture (%) | 32.14 |
| Average overlap percent | 36.82 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006911CDF | 26-150 | 125 | LAWVAWRQNRALVWVLLAAVAAVGCFLWFEHSAVVEATARVRQAGCGQGQGTATDTGESCWPLLEGVSARASDFTDRLQPLLAAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EX00-F1 | 10-137 | 92.75 | 90.90 | View in AlphaFoldDB ↗ |