DPCfam | MC393710
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Residues in low-complexity regions (%) | 10.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01348 |
| Sequences matching dominant architecture (%) | 81.97 |
| Average overlap percent | 26.67 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D5IBS4 | 437-520 | 83 | YRIKYILRLSCARTLARKHKSTVRTFMRRLGSGFLEEFFMEEEQALFFILFQKRPLTLHLPGLHRERIWYLDIIRMNDLLDFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B1NWD1-F1 | 440-505 | 100.00 | 52.80 | View in AlphaFoldDB ↗ |