DPCfam | MC393658
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 482 ± 61 aa |
| Residues in low-complexity regions (%) | 3.12 |
| Residues in coiled-coil regions (%) | 10.18 |
| Predicted disordered residues (%) | 32.16 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF06470 |
| Sequences matching dominant architecture (%) | 77.55 |
| Average overlap percent | 26.57 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G3VI46 | 1388-1905 | 518 | RDKVIPNKVGSYCIQFAFMVDKSTVLNSDQILVDVIPNEPIKLIPECLPSTPAVSNVPPIANRTLVKDMCLNIVDEHNNRTGTNL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6P5D8-F1 | 1447-1962 | 100.00 | 84.24 | View in AlphaFoldDB ↗ |