DPCfam | MC39362
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Residues in low-complexity regions (%) | 6.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.56 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7B3X9 | 683-819 | 137 | LLSLLSNPQFLAVSWASDPSKPSGVAAGGASTRYPCTRERTTNTFVYHRLELWIVYSIAIVMALAGVVSGLTALREEGVFRDNRF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q030-F1 | 607-751 | 96.92 | 84.93 | View in AlphaFoldDB ↗ |