DPCfam | MC393601
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 94 ± 7 aa |
| Residues in low-complexity regions (%) | 0.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01232 |
| Sequences matching dominant architecture (%) | 99.32 |
| Average overlap percent | 60.44 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5WKX0 | 32-131 | 100 | ERIIQFGEGNFLRGFVDWMIHTLNKKGLFNGSIVAIQPTPHGKVVPKLNAQDGLYTLAQRGMLNGTEVDEREIVTSISRGINPYT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q97L67-F1 | 15-105 | 98.91 | 96.24 | View in AlphaFoldDB ↗ |