DPCfam | MC393385
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 260 ± 30 aa |
| Residues in low-complexity regions (%) | 2.3 |
| Residues in coiled-coil regions (%) | 1.06 |
| Predicted disordered residues (%) | 15.78 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0JMD2 | 20-298 | 279 | LAQFYYADEELNQVATELDSLDGRKDPQRCTLLVNQFRSCQDNVLNIINQIMDECIPEERANRDFCVKFPEEIRHDNLAGQLWFG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HCC9-F1 | 18-287 | 99.63 | 89.36 | View in AlphaFoldDB ↗ |