DPCfam | MC39334
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Residues in low-complexity regions (%) | 0.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00750 |
| Sequences matching dominant architecture (%) | 98.92 |
| Average overlap percent | 22.23 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A9VK15 | 147-213 | 67 | DVLANLLKKVGYKVTKEYYINDAGAQIDTLIKSVYLRYKEALGEKISIEKGLYPGEYLKPIGNGLAK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A4J9D2-F1 | 154-212 | 98.33 | 93.35 | View in AlphaFoldDB ↗ |