DPCfam | MC393290
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 98 ± 18 aa |
| Residues in low-complexity regions (%) | 1.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.45 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1C6FW02 | 149-226 | 78 | LIDIEKIPDILLAHEIFHWIEMTNQQDIMTRNTTVVLWKIKALENKAHVRCLSEIAAMSFAKELLGLEFWPYVLDVLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A133CV83-F1 | 121-215 | 84.96 | 89.11 | View in AlphaFoldDB ↗ |