DPCfam | MC393220
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 125 ± 13 aa |
| Residues in low-complexity regions (%) | 4.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13482 |
| Sequences matching dominant architecture (%) | 55.81 |
| Average overlap percent | 1.21 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0U1DKH9 | 184-318 | 135 | LLAVYRPRRAALQSLLDGHLLGGTAVQWSDDTVRACFGCGECEQQVRATDDLFLVAGMRASQRARLIEAGVSTRRQLDDRADPVP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8F0B2-F1 | 82-212 | 100.00 | 92.82 | View in AlphaFoldDB ↗ |