DPCfam | MC392623
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 1155 ± 181 aa |
| Residues in low-complexity regions (%) | 2.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08043- PF08043- PF08043- PF08043- PF08043- PF08043- PF08043- PF08043- PF08043- PF08043- PF08043- PF08043- PF08043- PF08043 |
| Sequences matching dominant architecture (%) | 18.18 |
| Average overlap percent | 74.1 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U8DBK7 | 88-1437 | 1350 | DLAEMLHTEDPNTQASVNQDTVPPSDVQSMRWIFENWTLDSIGDHEGTKKLADEETRSGDVKSTSTRFESQALNGDKSCASIKVA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5PZ43-F1 | 96-1282 | 99.58 | 48.57 | View in AlphaFoldDB ↗ |