DPCfam | MC392511
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Residues in low-complexity regions (%) | 0.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04860 |
| Sequences matching dominant architecture (%) | 48.89 |
| Average overlap percent | 18.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003A0EE47 | 258-319 | 62 | TVHRVPLVLMSIQATNAGGFGNPAPFAKVFYKNELYPMIRKFYSVNHRLGQKIFDFDKYDLE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZMS9-F1 | 282-341 | 96.77 | 92.87 | View in AlphaFoldDB ↗ |