DPCfam | MC392496
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 174 ± 31 aa |
| Residues in low-complexity regions (%) | 7.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.17 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04788 |
| Sequences matching dominant architecture (%) | 98.33 |
| Average overlap percent | 35.47 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q8S7T7 | 18-134 | 117 | QVASSAQYIIEQFRATTGCGKIEGAVKSMYAAGRVRLAMLQDPAGGGAGGGGGGGRGHEGSFVMWQLAPSMWIVEMAVAGQHVAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LML7-F1 | 14-221 | 100.00 | 73.76 | View in AlphaFoldDB ↗ |