DPCfam | MC392014
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 81 ± 13 aa |
| Residues in low-complexity regions (%) | 2.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004C2FF76 | 360-434 | 75 | GDPRIPVLSLHDVGDLFVPFSMEQVYAQRVAAHRQSDLFVSRAIRGVGHCDFNQQELTEGFDDLTTWIHTGHRPA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0C2Y0-F1 | 338-414 | 92.77 | 98.03 | View in AlphaFoldDB ↗ |